Teakdeals.com

Similar sites

'teakdoor.com' icon teakdoor.com

Category

News and Media

Global Rank

267556

Rank in 1 month

153.7K

Estimate Value

8,124$

the thailand forum, with 1,000s of reviews & photos of thai beaches, resorts, restaurants, bars, nightlife, hotels, guesthouses and thai tourist attractions, visit teakdoor the best thailand forum.

    #bangkok

    #forum"

    #teakdoor

    #1998 laptop

    #tim sharky

    #teak door

    #tim sharky ward

    #mobilism books download

    #thailand

    #atheneum partners scam

    #top gear season 22 kickass

    #chiang mai


'teakwarehouse.com' icon teakwarehouse.com

Category

N/A

Global Rank

586125

Rank in 1 month

16.9K

Estimate Value

3,684$

    #accessories

    #dining

    #indoor

    #teak warehouse

    #teak outdoor furniture

    #teak furniture

    #teak bench

    #teak dining table

    #outdoor furniture

    #teak outdoor dining table


'teakandtwine.com' icon teakandtwine.com

Category

N/A

Global Rank

671932

Rank in 1 month

123.8K

Estimate Value

3,216$

    #teak &

    # twine

    #teakandtwine

    #torrance hart


'teakandthyme.com' icon teakandthyme.com

Category

N/A

Global Rank

1695369

Rank in 1 month

74.8K

Estimate Value

1,260$

Baking & Dessert Recipes - Teak & ThymeEmailFacebookInstagramPinterestmenu iconEmailFacebookInstagramPinterestsearch iconEmailFacebookInstagramPinterest

    #sans rival recipe

    #ube pie

    #kylie jenner olive oil cake

    #cheetos ice cream

    #tteokkochi

    #korean sweet potato

    #sushi vs kimbap

    #triangle kimbap

    #kimchi fridge

    #pork jowl

    #sauce for crispy pork belly

    #spicy fried cauliflower

    #mochi donuts

    #yuzu cheesecake

    #matcha cookies

    #mochi cupcakes

    #injeolmi

    #tiramisu cake

    #lemon meringue tarts

    #matcha crepe cake

    #soju cocktails

    #earl grey layer cake


'teakdeck.hr' icon teakdeck.hr

Category

N/A

Global Rank

N/A

Rank in 1 month

0

Estimate Value

N/A


'teakdeck.pl' icon teakdeck.pl

Category

N/A

Global Rank

N/A

Rank in 1 month

0

Estimate Value

N/A


'teakdecking.pro' icon teakdecking.pro

Category

N/A

Global Rank

N/A

Rank in 1 month

0

Estimate Value

N/A


'teakfellowship.org' icon teakfellowship.org

Category

N/A

Global Rank

N/A

Rank in 1 month

0

Estimate Value

N/A

    #teak fellowship

    #নেক্সট

    #প্রতিশ্রুতিবদ্ধ

    #programa

    #art dimensions

    #art rental los angeles

    #art rental

    #dimensions for art

    #brady smith

    #ডিমেনশিয়া

    #ডিমেনশিয়া

    #blg mind

    #মানসিক স্বাস্থ্য

    #mindcare

    #what color is teak

    #teak color

    #furniture restoration

    #teak furniture

    #teak decking

    #teakdecking systems

    #teak decking systems

    #teak boat deck

    #teak deck systems

    #john arrillaga jr

    #people of color conference


'teakfurnituree.com' icon teakfurnituree.com

Category

N/A

Global Rank

N/A

Rank in 1 month

0

Estimate Value

N/A


'teaktrade.hu' icon teaktrade.hu

Category

N/A

Global Rank

N/A

Rank in 1 month

0

Estimate Value

N/A

    #mandala jelentése

    #buddha

    #makramé

    #horgolt sapka

    #finom pamutszövet

    #pólófonal horgolás

    #gunagriha

    #sri chinmoy

    #halál

    #karmaguru

    #karma guru tibetshop

    #hangtál

    #tízmilliószoros nap 2021

    #trash polka

    #végtelen jel

    #fortis fortuna adiuvat

    #jin jang

    #constantine a démonvadász

    #mandala



Malware Scan Info

Macafee Check :

Email address with teakdeals.com
Found 0 emails of this domain


Recent Searched Sites

soapstoneestates.com icon Soapstoneestates.com (1 mins ago) / US

leopardfintech.com icon Leopardfintech.com (2 mins ago) / US

qylla.com icon Qylla.com (1 mins ago) / US

tousatsumanko.com icon Tousatsumanko.com (2 mins ago) / US

randolphbarnwell.com icon Randolphbarnwell.com (6 mins ago) / US

twinvee.com icon Twinvee.com (33 seconds ago) / US

anihonetwallpaper.com icon Anihonetwallpaper.com (1 mins ago) / JP

speakenglishwithtiffaniacademy.com icon Speakenglishwithtiffaniacademy.com (52 seconds ago) / US

battlehost.net icon Battlehost.net (7 mins ago) / US

radcom-sms.com icon Radcom-sms.com (10 seconds ago) / US

labec.spbstu.ru icon Labec.spbstu.ru (2 mins ago) / RU

csiss.org icon Csiss.org (35 seconds ago) / US

ftvmilfs.net icon Ftvmilfs.net (47 seconds ago) / US

guerrillamail.com icon Guerrillamail.com (25 seconds ago) / DE

northseaforme.com icon Northseaforme.com (1 mins ago) / US

teakdeals.com icon Teakdeals.com (0 seconds ago) / US

bridgemoorcare.com icon Bridgemoorcare.com (30 seconds ago) / US

parlourasalonaz.com icon Parlourasalonaz.com (6 seconds ago) / CA

myfreestyle.com icon Myfreestyle.com (45 seconds ago) / US

ctlclaw.com icon Ctlclaw.com (5 seconds ago) / US

Domain Informations

Teakdeals.com lookup results from whois.godaddy.com server:
  • Domain created: 2000-08-05T00:27:48Z
  • Domain updated: 2022-09-18T08:32:43Z
  • Domain expires: 2031-08-05T00:27:48Z 8 Years, 192 Days left
  • Website age: 22 Years, 172 Days
  • Registrar Domain ID: 32393261_DOMAIN_COM-VRSN
  • Registrar Url: http://www.godaddy.com
  • Registrar WHOIS Server: whois.godaddy.com
  • Registrar Abuse Contact Email: [email protected]
  • Registrar Abuse Contact Phone: 480-624-2505
  • Name server:
    • NS1.DREAMHOST.COM
    • NS2.DREAMHOST.COM
    • NS3.DREAMHOST.COM

Network
  • inetnum : 66.33.192.0 - 66.33.223.255
  • name : DREAMHOST-BLK1
  • handle : NET-66-33-192-0-1
  • status : Direct Allocation
  • created : 2001-04-17
  • changed : 2017-01-28
  • desc : ADDRESSES WITHIN THIS BLOCK ARE NON-PORTABLE,** For abuse issues, please contact [email protected] **,Address location was created regardless of geographic location.
Owner
  • organization : New Dream Network, LLC
  • handle : NDN
  • address : Array,Brea,CA,92821,US
Technical support
Abuse
  • handle : DAT5-ARIN
  • name : DreamHost Abuse Team
  • phone : +1-714-706-4182
  • email : [email protected]
Host Informations
Host nameapache2-ogle.candlestick.dreamhost.com
IP address66.33.210.106
LocationBrea United States
Latitude33.9339
Longitude-117.8854
Metro Code803
TimezoneAmerica/Los_Angeles
Postal92821
Check all domain's dns records

Port Scanner (IP: 66.33.210.106)
 › Ftp: 21
 › Ssh: 22
 › Telnet: 23
 › Smtp: 25
 › Dns: 53
 › Http: 80
 › Pop3: 110
 › Portmapper, rpcbind: 111
 › Microsoft RPC services: 135
 › Netbios: 139
 › Imap: 143
 › Ldap: 389
 › Https: 443
 › SMB directly over IP: 445
 › Msa-outlook: 587
 › IIS, NFS, or listener RFS remote_file_sharing: 1025
 › Lotus notes: 1352
 › Sql server: 1433
 › Point-to-point tunnelling protocol: 1723
 › My sql: 3306
 › Remote desktop: 3389
 › Session Initiation Protocol (SIP): 5060
 › Virtual Network Computer display: 5900
 › X Window server: 6001
 › Webcache: 8080

Spam Check (IP: 66.33.210.106)
 › Dnsbl-1.uceprotect.net:
 › Dnsbl-2.uceprotect.net:
 › Dnsbl-3.uceprotect.net:
 › Dnsbl.dronebl.org:
 › Dnsbl.sorbs.net:
 › Spam.dnsbl.sorbs.net:
 › Bl.spamcop.net:
 › Recent.dnsbl.sorbs.net:
 › All.spamrats.com:
 › B.barracudacentral.org:
 › Bl.blocklist.de:
 › Bl.emailbasura.org:
 › Bl.mailspike.org:
 › Bl.spamcop.net:
 › Cblplus.anti-spam.org.cn:
 › Dnsbl.anticaptcha.net:
 › Ip.v4bl.org:
 › Fnrbl.fast.net:
 › Dnsrbl.swinog.ch:
 › Mail-abuse.blacklist.jippg.org:
 › Singlebl.spamgrouper.com:
 › Spam.abuse.ch:
 › Spamsources.fabel.dk:
 › Virbl.dnsbl.bit.nl:
 › Cbl.abuseat.org:
 › Dnsbl.justspam.org:
 › Zen.spamhaus.org:

See Web Sites Hosted on 66.33.210.106
Fetching Web Sites Hosted

Keyword Suggestion
Teak deals
Teakdeals.com
Tech deals
Teak deals furniture
Teak deals reviews
Tekdeals
Teal deals
Tekdeals vape
Tekdeals review
Tekdeals bluetooth controller
Tekdeals hair growth serum
Tekdeals el-50448
Teamdeals
Teamdeals marketplace


Semrush Domain Overview
Domain Backlinks 2.8K
Rank 1.6M
Traffic 429
Costs0.9K USD

Site Inspections

Websites Listing
We found Websites Listing below when search with teakdeals.com on Search Engine

About Us - Teak Deals

Established in 2000, Teak deals is the nation’s leading specialist in solid teak outdoor furniture. We take pride in providing durable, beautiful furniture solutions to homes, …

Teakdeals.com

DA: 17 PA: 9 MOZ Rank: 26

72" Round Dining Table - Teak Deals

Features include: There is a 2" hole for umbrella, lid provided to cover hole if no umbrella used. The teak wood has been KILN DRY before the furniture was made. Stainless Steel hardware used for durability. Table …

Teakdeals.com

DA: 17 PA: 35 MOZ Rank: 53

Wholesale Teak Oil, 1 GALLON - Teak Outdoor Furniture

Wholesale Teak Oil is a penetrating oil that soaks into the wood and protects from within. Wholesale Teak Oil contains U.V. protectants to shield the wood from harmful sun rays and a mildewcide that makes it ideal for …

Teakdeals.com

DA: 17 PA: 16 MOZ Rank: 35

Terms & Conditions - Teak Deals

TEAK DEALS reserves the right to correct any errors, inaccuracies or omissions and to change or update information at any time without prior notice (including after you have …

Teakdeals.com

DA: 17 PA: 6 MOZ Rank: 26

Teakdeals | Ghent - Facebook

TEAKDEALS OUTLET – DE SPECIALIST IN EINDE REEKSEN EN PARTIJEN! Unieke meubelen outlet van de grootste merken aan de beste prijzen! Teakdeals | Ghent

Facebook.com

DA: 16 PA: 11 MOZ Rank: 31

Privacy Policy - Teak Deals

TeakDeals.com Phone from US: 805-680-9228 INFORMATION WE COLLECT We request information from you (including name, address, telephone number, email address and, …

Teakdeals.com

DA: 17 PA: 8 MOZ Rank: 30

Teak Deals - Project Photos & Reviews - Oxnard, CA US | Houzz

Oct 18, 2022 Teak Deals Furniture Stores and Showrooms 269 Reviews Overview Collections Catalogs Ideabooks Reviews Questions Activity Reviews Reviews About …

Houzz.com

DA: 13 PA: 28 MOZ Rank: 47

Contact Us - Teak Deals

Telephone 805-680-9228. Information. About Us; Delivery Information; Privacy Policy; Customer Service. Contact Us; Site Map

Teakdeals.com

DA: 17 PA: 10 MOZ Rank: 34

48" Round Butterfly Dining Table - Teak Deals

TeakDeals utilizes commercial-grade stainless steel in the manufacture of its furniture. Every detail is made to ensure the quality of the welds and finishes meet our stringent …

Teakdeals.com

DA: 17 PA: 43 MOZ Rank: 68

Teak Closeouts: discount teak furniture - easy ordering and fast …

You'll find $219 teak benches, $169 teak arm chairs, and teak tables starting at $499. If you're looking for a durable, quality folding chair, nothing beats the $99 teak folding …

Teakcloseouts.com

DA: 21 PA: 21 MOZ Rank: 31

Teak Deals 7-Piece Outdoor Dining Sets | Houzz

7-Piece Outdoor Teak Dining Set, 71" Rectangle Table, 6 Montana Stacking Chairs by Teak Deals. $2,474. 7-Piece Outdoor Teak Dining Set, 94" Oval Table, 6 Cahyo Stacking Arm …

Houzz.com

DA: 13 PA: 50 MOZ Rank: 40

Domains Expiration Date Updated
Site Provider Expiration Date
aisaf.org whois.godaddy.com 132 Days
ranchergovernment.com godaddy.com 3 Years, 283 Days
pictufy.com domain.com 62 Days
arcolive.com gmo.jp 19 Days
inclusivelife.co whois.godaddy.com 169 Days
greaterthanthat.org whois.godaddy.com 40 Days
thecrig.com godaddy.com 4 Days
nesandhillsoutfitters.com 35.com 61 Days
jemfindustrial.com tucows.com 158 Days
laretiradamadrid.com arsys.es 331 Days

    Browser All

    .com7.3M domains   

    .org1.2M domains   

    .edu55.2K domains   

    .net1M domains   

    .gov17.5K domains   

    .us39.1K domains   

    .ca76.7K domains   

    .de526.4K domains   

    .uk424.4K domains   

    .it74K domains   

    .au69.1K domains   

    .co45.7K domains   

    .biz18.1K domains   

    .info49.3K domains   

    .fr66.6K domains   

    .eu32.4K domains   

    .ru189.7K domains   

    .ph7.4K domains   

    .in76.2K domains   

    .vn26.2K domains   

    .cn76.1K domains   

    .ro26.1K domains   

    .ch15.1K domains   

    .at13.1K domains   

    Browser All